Rabbit Anti-Human CSF1R Polyclonal Antibody (DPABH-25759)

Rabbit Anti-Human CSF1R Polyclonal Antibody for IHC, WB, ICC-IF Datasheet

Bring this labeled antibody directly to your bench!

Online Inquiry Add to basket

Specifications


Host Species
Rabbit
Antibody Isotype
IgG
Species Reactivity
Human
Immunogen
Recombinant Protein, antigen sequence: NFDVFLQHNNTKLAIPQQSDFHNNRYQKVLTLNLDQVDFQHAGNYSCVASNVQGKHSTSMFFRVVESAYLNLSSEQNLIQEVTVGEGLNLKVMVEAYPGLQGFNWTYLGPFSDHQP
Conjugate
unconjugated

Applications


Application Notes
ICC-IF: 1-4 µg/ml
IHC: 1:50 - 1:200
WB: 4 µg/ml
*Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own experiment using appropriate negative and positive controls.

Data Examples


Immunohistochemical staining of human placenta shows moderate to strong cytoplasmic positivity in trophoblastic cells.
Western blot analysis in human cell line BEWO.

Target


Alternative Names
CSF1R; colony stimulating factor 1 receptor; FMS; CSFR; FIM2; HDLS
Entrez Gene ID
UniProt ID

Citations


Have you cited DPABH-25759 in a publication? Let us know and earn a reward for your research.

References


Chaika, OV; Chaika, N; et al. CSF-1 receptor insulin receptor chimera permits CSF-1-dependent differentiation of 3T3-L1 preadipocytes. JOURNAL OF BIOLOGICAL CHEMISTRY 272:11968-11974(1997).
Erblich, B; Zhu, LY; et al. Absence of Colony Stimulation Factor-1 Receptor Results in Loss of Microglia, Disrupted Brain Development and Olfactory Deficits. PLOS ONE 6:-(2011).

Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !

Online Inquiry

Name
Phone *
E-mail Address *
Service & Products Interested *
Project Description
Verification Code * Please input "diagnostics" as verification code.

Online Inquiry

Order Info: Rabbit Anti-Human CSF1R Polyclonal Antibody

Online Inquiry
  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!
  15% off your first purchase

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket