Synthetic peptide within Human CSAG1 aa 21-69 (C terminal). The exact sequence is proprietary. (NP_705611.1).Sequence: QVDWSRLYRDTGLVKMSRKPRASSPFSNNHPSTPKRFPRQPKREKGPVK Database link: Q6PB30
This gene encodes a member of a family of tumor antigens. The protein is expressed in chondrosarcomas, but may also be expressed in normal tissues such as testis. Alternative splicing of this gene results in two transcript variants encoding the same protein.
Citations
Publication ()
Have you cited DPABH-12760 in a publication? Let us know and earn a reward for your research.
My Review for Anti-CSAG1 (aa 21-69) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
