Anti-COX17 (aa 1-63) polyclonal antibody

Species Reactivity

Human

Immunogen

COX17 (NP_005685, 1 a.a. ~ 63 a.a) partial recombinant protein with GST tag. The sequence is MPGLVDSNPAPPESQEKKPLKPCCACPETKKARDACIIEKGEEHCGHLIEAHKECMRALG FKI

Conjugate

Alternative Names

COX17; COX17 cytochrome c oxidase copper chaperone; cytochrome c oxidase copper chaperone; cytochrome c oxidase 17 copper chaperone; cytochrome c oxidase assembly homolog 17; COX17 cytochrome c oxidase assembly homolog; human homolog of yeast mitochondria

Entrez Gene ID

UniProt ID

Antigen Description

Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes a protein which is not a structural subunit, but may be involved in the recruitment of copper to mitochondria for incorporation into the COX apoenzyme. This protein shares 92% amino acid sequence identity with mouse and rat Cox17 proteins. This gene is no longer considered to be a candidate gene for COX deficiency. A pseudogene COX17P has been found on chromosome 13.

Pathway

Cytochrome c oxidase; Electron Transport Chain; Mitochondrial protein import; Oxidative phosphorylation.