Specifications
Species Reactivity
Chicken
Immunogen
Full length native protein (purified) corresponding to Chicken Collagen II aa 78-1100. Purified preparation of lathyritic Collagen II from embryonic chicken sternum.Sequence: QYDPSKAADFGPGPMGLMGPRGPPGASGPPGPPGFQGVPGEPGEPGQTGP QGPRGPPGPPGKAGEDGHPGKPGRPGERG
Applications
Application Notes
Flow Cyt: Use at an assay dependent concentration. ICC/IF: Use at an assay dependent concentration; WB: Use a concentration of 1 - 2 μg/ml. Predicted molecular weight: 141 kDa; IHC-P: Use a concentration of 1 - 2 μg/ml.
Target
Alternative Names
COL2A1; collagen, type II, alpha 1; collagen alpha-1(II) chain; chondrocalcin; alpha-1 type II collagen; disproportionate micromelia; procollagen, type II, alpha 1; Dmm; Col2; Del1; Col2a; Col2a-1; M100856; Rgsc856; MGC90638;
Product Background
Antigen Description
Type II collagen is specific for cartilaginous tissues. It is essential for the normal embryonic development of the skeleton, for linear growth and for the ability of cartilage to resist compressive forces.
Pathway
Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem; Axon guidance, organism-specific biosystem; Developmental Biology, organism-specific biosystem; ECM-receptor interaction, organism-specific biosystem; ECM-receptor interaction, conserved biosystem; Endochondral Ossification, organism-specific biosystem;
Citations
Publication ()
Have you cited DCABH-7966 in a publication?
Let us know and earn a reward for your research.