Anti-CLDN16 (aa 1-73) polyclonal antibody

Species Reactivity

Human

Immunogen

CLDN16 (NP_006571, 1 a.a. ~ 73 a.a) partial recombinant protein with GST tag. The sequence is MTSRTPLLVTACLYYSYCNSRHLQQGVRKSKRPVFSHCQVPETQKTDTRHLSGARAGVCP CCHPDGLLATMRD

Conjugate

Alternative Names

CLDN16; claudin 16; HOMG3; PCLN1; claudin-16; PCLN-1; paracellin-1; hypomagnesemia 3, with hypercalciuria and nephrocalcinosis;

Entrez Gene ID

UniProt ID

Antigen Description

Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. These junctions are comprised of sets of continuous networking strands in the outwardly facing cytoplasmic leaflet, with complementary grooves in the inwardly facing extracytoplasmic leaflet. The protein encoded by this gene, a member of the claudin family, is an integral membrane protein and a component of tight junction strands. It is found primarily in the kidneys, specifically in the thick ascending limb of Henle, where it acts as either an intercellular pore or ion concentration sensor to regulate the paracellular resorption of magnesium ions. Defects in this gene are a cause of primary hypomagnesemia, which is characterized by massive renal magnesium wasting with hypomagnesemia and hypercalciuria, resulting in nephrocalcinosis and renal failure. This gene and the CLDN1 gene are clustered on chromosome 3q28.

Pathway

Cell adhesion molecules (CAMs); Cell junction organization; Cell-cell junction organization; Hepatitis C