CHODL (NP_079220, 23 a.a. ~ 94 a.a) partial recombinant protein with GST tag. The sequence is RVVSGQKVCFADFKHPCYKMAYFHELSSRVSFQEARLACESEGGVLLSLENEAEQKLIES MLQNLTKPGTGI
Conjugate
Unconjugated
Target
Alternative Names
CHODL; chondrolectin; MT75; PRED12; C21orf68; transmembrane protein MT75;
This gene encodes a type I membrane protein with a carbohydrate recognition domain characteristic of C-type lectins in its extracellular portion. In other proteins, this domain is involved in endocytosis of glycoproteins and exogenous sugar-bearing pathogens. This protein localizes predominantly to the perinuclear region. Several transcript variants encoding a few different isoforms have been found for this gene.
Citations
Publication ()
Have you cited DPAB-DC596 in a publication? Let us know and earn a reward for your research.
My Review for Anti-CHODL (aa 23-94) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
