CH25H (NP_003947, 206 a.a. ~ 272 a.a) partial recombinant protein with GST tag. The sequence is VNIWLSVEDHSGYNFPWSTHRLVPFGWYGGVVHHDLHHSHFNCNFAPYFTHWDKILGTLR TASVPAR
This is an intronless gene that is involved in cholesterol and lipid metabolism. The encoded protein is a membrane protein and contains clusters of histidine residues essential for catalytic activity. Unlike most other sterol hydroxylases, this enzyme is a member of a small family of enzymes that utilize diiron cofactors to catalyze the hydroxylation of hydrophobic substrates.
Pathway
Bile acid and bile salt metabolism; Metabolism of lipids and lipoproteins; Primary bile acid biosynthesis;
Citations
Publication ()
Have you cited DPAB-DC3706 in a publication? Let us know and earn a reward for your research.
My Review for Anti-CH25H (aa 206-272) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
