Rabbit Anti-CDK5R1 Polyclonal antibody (DPABH-22160)

Rabbit Anti-Human CDK5R1 Polyclonal antibody for WB, IP, ELISA Datasheet

Bring this labeled antibody directly to your bench!

Online Inquiry Add to basket

Specifications


Host Species
Rabbit
Antibody Isotype
IgG
Species Reactivity
Human, Mouse, Rat
Immunogen
p35 fusion protein, sequence: AQPPPAQPPAPPASQLSGSQTGGSSSVKKAPHPAVTSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLGLDR (99-307aa encoded by BC020580)
Conjugate
unconjugated

Applications


Application Notes
WB: 1:500-1:1000
IP: 0.5-4.0 ug for IP and 1:500-1:1000 for WB
*Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own experiment using appropriate negative and positive controls.

Target


Alternative Names
CDK5R1; cyclin-dependent kinase 5, regulatory subunit 1 (p35); p23; p25; p35; CDK5R
Entrez Gene ID
UniProt ID

Citations


Have you cited DPABH-22160 in a publication? Let us know and earn a reward for your research.

References


Alvarez, A; Toro, R; et al. Inhibition of tau phosphorylating protein kinase cdk5 prevents beta-amyloid-induced neuronal death. FEBS LETTERS 459:421-426(1999).
Amin, ND; Albers, W; et al. Cyclin-dependent kinase 5 (cdk5) activation requires interaction with three domains of p35. JOURNAL OF NEUROSCIENCE RESEARCH 67:354-362(2002).

Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !

Online Inquiry

Name
Phone *
E-mail Address *
Service & Products Interested *
Project Description
Verification Code * Please input "diagnostics" as verification code.

Online Inquiry

Order Info: Rabbit Anti-CDK5R1 Polyclonal antibody

Online Inquiry
  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!
  15% off your first purchase

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket