Rabbit Anti-Human CCDC174 Polyclonal Antibody (DPABH-28977)

Specifications


Host Species
Rabbit
Antibody Isotype
IgG
Species Reactivity
Human
Immunogen
Recombinant Protein, antigen sequence: KAELFRKQEEFKQEKLLKDSGVFGKPKTTNKKPSIWSKQNVGVSNRAEKDAEQKIEEQKTLDKAREKLEEKAKLYEKMTKGDFIDEEVEDMYLVDFTQKI
Conjugate
Unconjugated

Applications


Application Notes
IHC: 1:20 - 1:50
ICC-IF: 1-4 µg/ml
*Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own experiment using appropriate negative and positive controls.

Data Examples


Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.

Target


Alternative Names
CCDC174; coiled-coil domain containing 174; C3orf19; coiled-coil domain-containing protein 174
Entrez Gene ID
UniProt ID

Citations


Have you cited DPABH-28977 in a publication? Let us know and earn a reward for your research.

Related Products


Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket

References


TANAKA, T; PARRY, DAD; et al. COMPARISON OF MOLECULARLY CLONED BULLOUS PEMPHIGOID ANTIGEN TO DESMOPLAKIN-I CONFIRMS THAT THEY DEFINE A NEW FAMILY OF CELL-ADHESION JUNCTION PLAQUE PROTEINS. JOURNAL OF BIOLOGICAL CHEMISTRY 266:12555-12559(1991).

Online Inquiry

Name:
Phone: *
E-mail Address: *
Service & Products Interested: *
Project Description:
Verification Code: * Please input "diagnostics" as verification code.

Online Inquiry

  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket