Recombinant fragment corresponding to Human CASC4 aa 301-384 (internal sequence).Sequence: DSHINHNGNPGTSKQNPSSPLQRLIPGSNLDSEPRIQTDILKQATKDRVS DFHKLKQSRFFDENESPVDPQHGSKLADYNGDDG Database link: Q6P4E1
Conjugate
Unconjugated
Applications
Application Notes
ICC/IF: 1 - 4 μg/ml; IHC-P: 1/200 - 1/500.
Target
Alternative Names
CASC4; cancer susceptibility candidate 4; protein CASC4; DKFZp459F1927; H63; gene associated with HER-2/neu overexpression; cancer susceptibility candidate gene 4 protein; MGC74708;
CASC4 (cancer susceptibility candidate 4) is a protein-coding gene. Diseases associated with CASC4 include ovarian cancer, and soft tissue sarcoma. An important paralog of this gene is GOLM1.
Custom Antibody Labeling
We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More
Citations
Have you cited DPABH-14728 in a publication? Let us know and earn a reward for your research.
Behrends, U; Schneider, I; et al. Novel tumor antigens identified by autologous antibody screening of childhood medulloblastoma cDNA libraries. INTERNATIONAL JOURNAL OF CANCER 106:244-251(2003).
Berleth, ES; Nadadur, S; et al. Identification, characterization, and cloning of TIP-B1, a novel protein inhibitor of tumor necrosis factor-induced lysis. CANCER RESEARCH 59:5497-5506(1999).
Payment methods we support:
Invoice / Purchase Order
Credit card
My Review for Anti-CASC4 polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Certificate of Analysis
