Recombinant fragment corresponding to Human C7ORF50 aa 72-132.Sequence: KERKKEERQRLREAGLVAQHPPARRSGAELALDYLCRWAQKHKNWRFQKT RQTWLLLHMYD Database link: Q9BRJ6
Conjugate
Unconjugated
Applications
Application Notes
IHC-P: 1/50 - 1/200.
Target
Alternative Names
C7ORF50; chromosome 7 open reading frame 50; uncharacterized protein C7orf50; MGC11257; YCR016W;
My Review for Anti-C7ORF50 (aa 72-132) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.