Recombinant fragment within Human C12orf66 aa 176-271 (internal sequence). The exact sequence is proprietary.Sequence: HHPILSPLESSFQLEVDVLCHLLKAQAQVSEWKFLPSLVNLHSAHTKLQT WGQIFEKQRETKKHLFGGQSQKAVQPPHLFLWLMKLKNMLLAKFSF Database link: Q96MD2
Conjugate
Unconjugated
Applications
Application Notes
IHC-P: 1/20 - 1/50.
Target
Alternative Names
C12ORF66; chromosome 12 open reading frame 66; UPF0536 protein C12orf66; FLJ32549;
My Review for Anti-C12ORF66 (aa 176-271) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
