Synthetic peptide within Human C11orf52 aa 74-123 (C terminal). The exact sequence is proprietary. (NP_542390).Sequence: SNLHYADIQVCSRPHAREVKHVHLENATEYATLRFPQATPRYDSKNGTLV Database link: Q96A22
Conjugate
Unconjugated
Applications
Application Notes
WB: 1 μg/ml;
Target
Alternative Names
C11ORF52; chromosome 11 open reading frame 52; uncharacterized protein C11orf52;
NADH:ubiquinone oxidoreductase (complex I) catalyzes the transfer of electrons from NADH to ubiquinone (coenzyme Q) in the first step of the mitochondrial respiratory chain, resulting in the translocation of protons across the inner mitochondrial membrane. This gene encodes a complex I assembly factor. Mutations in this gene cause progressive encephalopathy resulting from mitochondrial complex I deficiency.
Pathway
MAPK signaling pathway;
Citations
Publication ()
Have you cited DPABH-12379 in a publication? Let us know and earn a reward for your research.
My Review for Anti-C11ORF52 (aa 74-123) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
