ATP6V0D2 (NP_689778, 238 a.a. ~ 306 a.a) partial recombinant protein with GST tag. The sequence is ETLYPTFGKLYPEGLRLLAQAEDFDQMKNVADHYGVYKPLFEAVGGSGGKTLEDVFYERE VQMNVLAFN
Conjugate
Unconjugated
Target
Alternative Names
ATP6V0D2; ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d2; VMA6; ATP6D2; V-type proton ATPase subunit d 2; V-ATPase subunit d 2; vacuolar proton pump subunit d 2;
ATP6V0D2 (ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d2) is a protein-coding gene. Diseases associated with ATP6V0D2 include osteopetrosis, and renal tubular acidosis, and among its related super-pathways are Insulin receptor recycling and Insulin receptor signalling cascade. GO annotations related to this gene include hydrogen ion transmembrane transporter activity and protein binding. An important paralog of this gene is ATP6V0D1.
Pathway
Collecting duct acid secretion; Disease; Epithelial cell signaling in Helicobacter pylori infection; Iron uptake and transport.
Citations
Publication ()
Have you cited DPAB-DC1157 in a publication? Let us know and earn a reward for your research.
My Review for Anti-ATP6V0D2 (aa 238-306) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
