Anti-ATP6V0D1 (aa 238-308) polyclonal antibody

Species Reactivity

Human

Immunogen

ATP6V0D1 (NP_004682, 238 a.a. ~ 308 a.a) partial recombinant protein with GST tag. The sequence is AKLFPHCGRLYPEGLAQLARADDYEQVKNVADYYPEYKLLFEGAGSNPGDKTLEDRFFEH EVKLNKLAFLN

Conjugate

Alternative Names

ATP6V0D1; ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d1; P39; VATX; VMA6; ATP6D; ATP6DV; VPATPD; V-type proton ATPase subunit d 1; V-ATPase, subunit D; V-ATPase subunit d 1; V-ATPase AC39 subunit; 32 kDa accessory protein; vacuolar proton pump s

Entrez Gene ID

UniProt ID

Antigen Description

This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c, c, and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This encoded protein is known as the D subunit and is found ubiquitously.

Pathway

Collecting duct acid secretion; Disease; Epithelial cell signaling in Helicobacter pylori infection; Insulin receptor recycling.