ARL6IP5 (NP_006398, 1 a.a. ~ 64 a.a) partial recombinant protein with GST tag. The sequence is MDVNIAPLRAWDDFFPGSDRFARPDFRDISKWNNRVVSNLLYYQTNYLVVAAMMISIVGF LSPF
Conjugate
Unconjugated
Target
Alternative Names
ARL6IP5; ADP-ribosylation factor-like 6 interacting protein 5; JWA; jmx; hp22; PRAF3; DERP11; HSPC127; addicsin; GTRAP3-18; PRA1 family protein 3; JM5; aip-5; protein JWa; PRA1 domain family 3; ARL-6-interacting protein 5; dermal papilla derived protein 1
Expression of this gene is affected by vitamin A. The encoded protein of this gene may be associated with the cytoskeleton. A similar protein in rats may play a role in the regulation of cell differentiation. The rat protein binds and inhibits the cell membrane glutamate transporter EAAC1. The expression of the rat gene is upregulated by retinoic acid, which results in a specific reduction in EAAC1-mediated glutamate transport.
Citations
Publication ()
Have you cited DPAB-DC238 in a publication? Let us know and earn a reward for your research.
My Review for Anti-ARL6IP5 (aa 1-64) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
