Anti-ARID5B (aa 77-126) polyclonal antibody

Antibody Isotype

IgG

Species Reactivity

Human

Immunogen

Synthetic peptide within Human ARID5B aa 77-126 (N terminal). The exact sequence is proprietary. Isoform 3Sequence: FLPEDTPQGRNSDHGEDEVIAVSEKVIVKLEDLVKWVHSDFSKWRCGFHA Database link: Q14865-3 Run BLAST with Run BLAST with

Conjugate

Application Notes

WB: 1 μg/ml.

Alternative Names

ARID5B; AT rich interactive domain 5B (MRF1-like); AT-rich interactive domain-containing protein 5B; FLJ21150; MRF2; MRF1-like protein; ARID domain-containing protein 5B; modulator recognition factor 2 (MRF2); DESRT; MRF-2; FLJ41888;

Entrez Gene ID

UniProt ID

Antigen Description

Transcription coactivator that binds to the 5-AATA[CT]-3 core sequence and plays a key role in adipogenesis and liver development. Acts by forming a complex with phosphorylated PHF2, which mediates demethylation at Lys-336, leading to target the PHF2-ARID5B complex to target promoters, where PHF2 mediates demethylation of dimethylated Lys-9 of histone H3 (H3K9me2), followed by transcription activation of target genes. The PHF2-ARID5B complex acts as a coactivator of HNF4A in liver. Required for adipogenesis: regulates triglyceride metabolism in adipocytes by regulating expression of adipogenic genes. Overexpression leads to induction of smooth muscle marker genes, suggesting that it may also act as a regulator of smooth muscle cell differentiation and proliferation. Represses the cytomegalovirus enhancer.