Recombinant full length protein corresponding to Human Apolipoprotein F aa 37-326. The sequence corresponds to the mature form of Human Apolipoprotein F including the propeptide. Swissprot: Q13790.Sequence: TSYGKQTNVLMHFPLSLESQTPSSDPLSCQFLHPKSLPGFSHMAPLPK
Conjugate
Unconjugated
Applications
Application Notes
WB: 1 μg/ml;
Target
Alternative Names
APOF; apolipoprotein F; LTIP; Apo-F; lipid transfer inhibitor protein;
Minor apolipoprotein that associates with LDL. Inhibits cholesteryl ester transfer protein (CETP) activity and appears to be an important regulator of cholesterol transport. Also associates to a lesser degree with VLDL, Apo-AI and Apo-AII.
Pathway
LDL-mediated lipid transport; Lipoprotein metabolism; Metabolism of lipids and lipoproteins;
Citations
Publication ()
Have you cited DPABH-09347 in a publication? Let us know and earn a reward for your research.
My Review for Anti-APOF (full length) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
