AP1M1 (NP_115882, 1 a.a. ~ 74 a.a) partial recombinant protein with GST tag. The sequence is MSASAVYVLDLKGKVLICRNYRGDVDMSEVEHFMPILMEKEEEGMLSPILAHGGVRFMWI KHNNLYLVATSKKN
Conjugate
Unconjugated
Target
Alternative Names
AP1M1; adaptor-related protein complex 1, mu 1 subunit; AP47; CLTNM; MU-1A; CLAPM2; AP-1 complex subunit mu-1; mu-adaptin 1; mu1A-adaptin; HA1 47 kDa subunit; clathrin adaptor protein AP47; AP-mu chain family member mu1A; golgi adaptor AP-1 47 kDa protein
The protein encoded by this gene is the medium chain of the trans-Golgi network clathrin-associated protein complex AP-1. The other components of this complex are beta-prime-adaptin, gamma-adaptin, and the small chain AP1S1. This complex is located at the Golgi vesicle and links clathrin to receptors in coated vesicles. These vesicles are involved in endocytosis and Golgi processing. Alternatively spliced transcript variants encoding distinct protein isoforms have been found for this gene.
Pathway
Adaptive Immune System; Disease; Golgi Associated Vesicle Biogenesis; Host Interactions of HIV factors.
Citations
Publication ()
Have you cited DPAB-DC3687 in a publication? Let us know and earn a reward for your research.
A: DPAB-DC3687 antibodies store at -20°C or lower. Aliquot to avoid repeated freezing and thawing..
Customer Reviews
My Review for Anti-AP1M1 (aa 1-74) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
