Synthetic peptide within Human ADPRHL1 aa 120-169 (internal sequence). The exact sequence is proprietary. (NP_954631).Sequence: LAEEYCRKTIRHTAEYQEHWFYFEAKWQFYLEERKISKDSENKAIFPDNY Database link: Q8NDY3-2
Conjugate
Unconjugated
Applications
Application Notes
WB: 1 μg/ml.
Target
Alternative Names
ADPRHL1; ADP-ribosylhydrolase like 1; [Protein ADP-ribosylarginine] hydrolase-like protein 1; ARH2; ADP-ribosyl-hydrolase; ADP-ribosylhydrolase 2;
ADPRHL1 (ADP-ribosylhydrolase like 1) is a protein-coding gene. GO annotations related to this gene include ADP-ribosylarginine hydrolase activity and magnesium ion binding. An important paralog of this gene is ADPRH.
Citations
Publication ()
Have you cited DPABH-12479 in a publication? Let us know and earn a reward for your research.
My Review for Anti-ADPRHL1 (aa 120-169) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.