ADAM29 (NP_055084, 339 a.a. ~ 398 a.a) partial recombinant protein with GST tag. The sequence is GMNHDEDTCRCSQPRCIMHEGNPPITKFSNCSYGDFWEYTVERTKCLLETVHTKDIFNVK
Conjugate
Unconjugated
Target
Alternative Names
ADAM29; ADAM metallopeptidase domain 29; CT73; svph1; disintegrin and metalloproteinase domain-containing protein 29; cancer/testis antigen 73; metallaproteinase-disintegrin (ADAM29); a disintegrin and metalloproteinase domain 29;
This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. The protein encoded by this gene is highly expressed in testis and may be involved in human spermatogenesis. Alternative splicing results in multiple transcript variants that encode the same protein.
Citations
Publication ()
Have you cited DPAB-DC354 in a publication? Let us know and earn a reward for your research.
My Review for Anti-ADAM29 (aa 339-398) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
