Synthetic peptide within Human ACSS1 aa 125-174 (internal sequence). The exact sequence is proprietary. Isoform 3Sequence: QHVLVAHRTDNKVHMGDLDVPLEQEMAKEDPVCAPESMGSEDMLFMLYTS Database link: Q9NUB1-3
Conjugate
Unconjugated
Applications
Application Notes
WB: 1 μg/ml.
Target
Alternative Names
ACSS1; acyl-CoA synthetase short-chain family member 1; ACAS2L, acetyl Coenzyme A synthetase 2 (AMP forming) like; acetyl-coenzyme A synthetase 2-like, mitochondrial; AceCS2L; dJ568C11.3; MGC33843; acetate--CoA ligase 2; ACAS2L; ACECS1; FLJ45659;
Important for maintaining normal body temperature during fasting and for energy homeostasis. Essential for energy expenditure under ketogenic conditions (By similarity). Converts acetate to acetyl-CoA so that it can be used for oxidation through the tricarboxylic cycle to produce ATP and CO(2).
My Review for Anti-ACSS1 (aa 125-174) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
