Anti-ABCA6 polyclonal antibody (DPABH-27784)

Rabbit anti-Mouse ABCA6 (full length) polyclonal antibody for WB, IHC-P Datasheet

Online Inquiry Add to basket

Specifications


Host Species
Rabbit
Antibody Isotype
IgG
Species Reactivity
Mouse, Rat, Human
Immunogen
Recombinant full length protein corresponding to Mouse ABCA6 aa 1-1624.Sequence: MKELSVHVRQQTRALLHKILLKKWRRKRESLLEWSIPIIIGLHMGLFSYL ARNIQVLEVPPQDLGSLNEFNGSSLVVVYTPISNITQQIMNKTTFAPTMK GTRIIGVPSIEDLEVLLHNIPDALGVIFNDSFSYQLKVLRMYGNPFLKED LLAHCWDTHSQAFCSLSKYWE
Conjugate
Unconjugated

Applications


Application Notes
WB: 1/500 - 1/2000; IHC-P: 1/50 - 1/200.
*Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own experiment using appropriate negative and positive controls.

Target


Alternative Names
ABCA6; ATP-binding cassette, sub-family A (ABC1), member 6; ATP-binding cassette sub-family A member 6; ATP-binding cassette transporter sub-family A member 6; 6330565N06Rik
Entrez Gene ID
UniProt ID

Product Background


Pathway
ABC transporters;

Citations


Have you cited DPABH-27784 in a publication? Let us know and earn a reward for your research.

References


Baecklund, F; Foo, JN; et al. A comprehensive evaluation of the role of genetic variation in follicular lymphoma survival. BMC MEDICAL GENETICS 15:-(2014).

Related Products


Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !

Online Inquiry

Name:
Phone: *
E-mail Address: *
Service & Products Interested: *
Project Description:
Verification Code: * Please input "diagnostics" as verification code.

Online Inquiry

Order Info: Anti-ABCA6 polyclonal antibody

Online Inquiry
  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!
  15% off your first purchase

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket