Synthetic peptide from a region within: TFLVSCEHDV LRDDALLYKK RLEDQGVPVS WYHAEDGFHG CISLFDKQPF, corresponding to C terminal amino acids 340-389 of Mouse Gm13178 (NP_001079005). TFLVSCEHDVLRDDALLYKKRLEDQGVPVSWYHAEDGFHG CISLFDKQPF Run BLAST with Run BLAST w
My Review for Anti-Gm13178 (aa 340-389) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
