Specifications
Immunogen
Synthetic peptide of human ISGF3G that is within the following sequence:PWKHAGKQDFREDQDAAFFKAWAIFKGKYKEGDTGGPAVW KTRLRCALNK.
Applications
Application Notes
ICC/IF: 1 μg/ml; WB: 1 - 5 μg/ml; IHC-P: 4 - 8 μg/ml.
Target
Alternative Names
IRF9; interferon regulatory factor 9; interferon stimulated transcription factor 3, gamma (48kD) ,interferon stimulated transcription factor 3, gamma 48kDa , ISGF3G; IFN alpha responsive transcription factor subunit; IFN-alpha-responsive transcription fac
Product Background
Antigen Description
Interferon regulatory factor 9 is a protein that in humans is encoded by the IRF9 gene. IRF9 has been shown to interact with STAT2 and STAT1.Transcription regulatory factor that mediates signaling by type I IFNs (IFN-alpha and IFN-beta). Following type I
Pathway
Cytokine Signaling in Immune system, organism-specific biosystem; Hepatitis C, organism-specific biosystem; Hepatitis C, conserved biosystem; Herpes simplex infection, organism-specific biosystem; Herpes simplex infection, conserved biosystem; IFN-gamma pathway, organism-specific biosystem; Immune System, organism-specific biosystem; Influenza A, organism-specific biosystem; Influenza A, conserved biosystem; Interferon Signaling, organism-specific biosystem; Interferon alpha/beta signaling, orga
Citations
Publication ()
Have you cited CPBT-54164RH in a publication?
Let us know and earn a reward for your research.
COA
Loading ......
