This antibody was developed against recombinant C14orf39 protein corresponding to amino acids: EVDEMEIEINYLNQQISRHNETKALSETLEEKNKNTENRKELKERIFGKDEHVLTLNKTQ SSQLFLPYESQKLVRPIK
Conjugate
Unconjugated
Applications
Application Notes
IHC: 1:200 - 1:500
Target
Alternative Names
C14orf39; chromosome 14 open reading frame 39; protein SIX6OS1; six6 opposite strand transcript 1
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
