ZNF85 (NP_003420, 2 a.a. ~ 76 a.a) partial recombinant protein with GST tag. The sequence is GPLTFRDVAIEFSLKEWQCLDTAQRNLYRNVMLENYRNLVFLGITVSKPDLITCLEQGKE AWSMKRHEIMVAKPT
Conjugate
Unconjugated
Target
Alternative Names
ZNF85; zinc finger protein 85; HPF4; HTF1; zinc finger protein 85 (HPF4, HTF1);
ZNF85 (zinc finger protein 85) is a protein-coding gene. Diseases associated with ZNF85 include testis seminoma, and heparin-induced thrombocytopenia. GO annotations related to this gene include transcription corepressor activity and sequence-specific DNA binding transcription factor activity. An important paralog of this gene is ZNF486.
Citations
Publication ()
Have you cited DPAB-DC3209 in a publication? Let us know and earn a reward for your research.
My Review for Anti-ZNF85 (aa 2-76) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
