Synthetic peptide within Human ZNF671 aa 485-534 (C terminal). The exact sequence is proprietary. (NP_079109)Sequence: GKAFTQRPNLIRHWKVHTGERPYVCSECGREFIRKQTLVLHQRVHAGEKL Database link: Q8TAW3
Conjugate
Unconjugated
Applications
Application Notes
WB: 1 μg/ml.
Target
Alternative Names
ZNF671; zinc finger protein 671; FLJ23506; hypothetical protein FLJ23506;
We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More
Citations
Have you cited DPABH-12754 in a publication? Let us know and earn a reward for your research.
Hsieh, JC; Slater, SA; et al. Analysis of Hairless Corepressor Mutants to Characterize Molecular Cooperation With the Vitamin D Receptor in Promoting the Mammalian Hair Cycle. JOURNAL OF CELLULAR BIOCHEMISTRY 110:671-686(2010).
Katoh, O; Oguri, T; et al. ZK1, a novel Kruppel-type zinc finger gene, is induced following exposure to ionizing radiation and enhances apoptotic cell death on hematopoietic cells. BIOCHEMICAL AND BIOPHYSICAL RESEARCH COMMUNICATIONS 249:595-600(1998).
Payment methods we support:
Invoice / Purchase Order
Credit card
My Review for Anti-ZNF671 polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.