Synthetic peptide within Human ZNF526 aa 184-233 (N terminal). The exact sequence is proprietary.Sequence: PPPSPPSEVKMEPYECPECSTLCATPEEFLEHQGTHFDSLEKEERNGLEE Database link: Q8TF50
Conjugate
Unconjugated
Applications
Application Notes
WB: 1 μg/ml.
Target
Alternative Names
ZNF526; zinc finger protein 526; KIAA1951; MGC4267; DKFZp762O059;
We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More
Citations
Have you cited DPABH-13951 in a publication? Let us know and earn a reward for your research.
Roy, LD; Sahraei, M; et al. MUC1 enhances invasiveness of pancreatic cancer cells by inducing epithelial to mesenchymal transition. ONCOGENE 30:1449-1459(2011).
Kobayashi, Y; Umemoto, T; et al. Functional characterization and substrate specificity of a novel gene encoding zinc finger-like protein, ZfLp, in Xenopus laevis oocytes. JOURNAL OF TOXICOLOGICAL SCIENCES 37:699-709(2012).
Payment methods we support:
Invoice / Purchase Order
Credit card
My Review for Anti-ZNF526 polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Certificate of Analysis