Recombinant fragment corresponding to Human Zinc finger protein 460 aa 120-198.Sequence: GKMSLEHEGLATADGICSMMIQNQVSPEDALYGFDSYGPVTDSLIHEGEN SYKFEEMFNENCFLVQHEQILPRVKPYDC Database link: Q14592
Conjugate
Unconjugated
Applications
Application Notes
IHC-P: 1/1000 - 1/2500;
Target
Alternative Names
ZNF460; zinc finger protein 460; HZF8; ZNF272; zinc finger protein 272; zinc finger protein HZF8;
My Review for Anti-ZNF460 (aa 120-198) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
