ZIC4 (NP_115529, 249 a.a. ~ 319 a.a) partial recombinant protein with GST tag. The sequence is SDRKKHSHVHTSDKPYTCKVRGCDKCYTHPSSLRKHMKVHGRSPPPSSGYDSATPSALVS PSSDCGHKSQV
Conjugate
Unconjugated
Target
Alternative Names
ZIC4; Zic family member 4; zinc finger protein ZIC 4; zinc family member 4 protein HZIC4; zinc finger protein of the cerebellum 4;
This gene encodes a member of the ZIC family of C2H2-type zinc finger proteins. Members of this family are important during development, and have been associated with X-linked visceral heterotaxy and holoprosencephaly type 5. This gene is closely linked to the gene encoding zinc finger protein of the cerebellum 1, a related family member on chromosome 3. Heterozygous deletion of these linked genes is involved in Dandy-Walker malformation, which is a congenital cerebellar malformation. Multiple transcript variants have been identified for this gene.
Citations
Publication ()
Have you cited DPAB-DC3461 in a publication? Let us know and earn a reward for your research.
My Review for Anti-ZIC4 (aa 249-319) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
