Recombinant full length protein (His-tag) corresponding to Human Secretory lectin ZG16 aa 17-167. (10aa N-Terminal His-tag. Produced in E.coli).Sequence: NAIQARSSSYSGEYGSGGGKRFSHSGNQLDGPITALRVRVNTYYIVGLQV RYGKVWSDYVGGRNGDLEEIFLHPGESVIQVSGKYKWYLKKLVFVTDKGR
Conjugate
Unconjugated
Target
Alternative Names
ZG16; zymogen granule protein 16; JCLN; JCLN1; ZG16A; zymogen granule membrane protein 16; secretory lectin ZG16; zymogen granule protein 16 homolog; jacalin-like lectin domain containing;
May play a role in protein trafficking. May act as a linker molecule between the submembranous matrix on the luminal side of zymogen granule membrane (ZGM) and aggregated secretory proteins during granule formation in the TGN.
Citations
Publication ()
Have you cited DPABH-11703 in a publication? Let us know and earn a reward for your research.
My Review for Anti-ZG16 (full length) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
