Full length protein corresponding to Human ZBED5 aa 1-693.
Sequence:
MIAPILCILSYNFNTFAILNVYSKLTMFCTTNSLPMDLLLKQGSLKQEVE SFCYQIVSESNDQKVGILQSEDKQLQPSVSKKSEGELSRVKFISNSNKIT FSKKPKRRKYDESYLSFGFTYFGNRDAPHAQCVLCKKILSNSSLAPSKLR RHLETKHAAYKDKDISFFKQHLDSPENNKPPT
Conjugate
Unconjugated
Applications
Application Notes
WB: 1 μg/ml.
Target
Alternative Names
ZBED5; zinc finger, BED-type containing 5; zinc finger BED domain-containing protein 5; Buster1; transposon-derived Buster1 transposase-like protein; FLJ41239;
ZBED5 contains 1 BED type zinc finger and it may be derived from an ancient transposon that has lost its ability to translocate. This gene is unusual in that its coding sequence is mostly derived from Charlie like DNA transposon. There is mRNA and EST evidence to suggest that this gene is transcribed. The encoded protein shares 70% identity with Charlie 1 transposase, however, this gene does not appear to be an active DNA transposon as it is not flanked by terminal inverted repeats. The exact function of this gene product is not known.
Citations
Publication ()
Have you cited DPABH-10049 in a publication? Let us know and earn a reward for your research.
My Review for Anti-ZBED5 (full length) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
