Rabbit Anti-VNN2 Polyclonal antibody (DPABH-12309)

Rabbit Anti-Human VNN2 Polyclonal antibody for WB, IF, ELISA Datasheet

Online Inquiry Add to basket   

Specifications


Host Species
Rabbit
Antibody Isotype
IgG
Species Reactivity
Human
Immunogen
VNN2 fusion protein, sequence: EIHLSPGKFEVLKDGRLVNKNGSSGPILTVSLFGRWYTKDSLYSSCGTSNSAITYLLIFILLMIIALQNIVML (448-520aa encoded by BC126145)
Conjugate
unconjugated

Applications


Application Notes
WB: 1:500-1:1000
IF: 1:20-1:200
*Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own experiment using appropriate negative and positive controls.

Target


Alternative Names
VNN2; vanin 2; FOAP-4; GPI-80; vascular non-inflammatory molecule 2; vanin-2
Entrez Gene ID
UniProt ID

Citations


Have you cited DPABH-12309 in a publication? Let us know and earn a reward for your research.

References


Nitto, T; Inoue, T; et al. Alternative spliced variants in the pantetheinase family of genes expressed in human neutrophils. GENE 426:57-64(2008).

Related Products


Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !

Online Inquiry

Name
Phone *
E-mail Address *
Service & Products Interested *
Project Description
Verification Code * Please input "diagnostics" as verification code.

Online Inquiry

Order Info: Rabbit Anti-VNN2 Polyclonal antibody

Online Inquiry
  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!
  15% off your first purchase

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket