VAMP5 (NP_006625, 1 a.a. ~ 70 a.a) partial recombinant protein with GST tag. The sequence is MAGIELERCQQQANEVTEIMRNNFGKVLERGVKLAELQQRSDQLLDMSSTFNKTTQNLAQ KKCWENIRYR
Conjugate
Unconjugated
Target
Alternative Names
VAMP5; vesicle-associated membrane protein 5; VAMP-5; myobrevin;
Synaptobrevins/VAMPs, syntaxins, and the 25-kD synaptosomal-associated protein are the main components of a protein complex involved in the docking and/or fusion of vesicles and cell membranes. The VAMP5 gene is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family and the SNARE superfamily. This VAMP family member may participate in vesicle trafficking events that are associated with myogenesis.
Pathway
SNARE interactions in vesicular transport.
Citations
Publication ()
Have you cited DPAB-DC295 in a publication? Let us know and earn a reward for your research.
My Review for Anti-VAMP5 (aa 1-70) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
