USP51 (NP_958443, 261 a.a. ~ 337 a.a) partial recombinant protein with GST tag. The sequence is KHIHKHAETKQHHLAVDLYHGVIYCFMCKDYVYDKDIEQIAKETKEKILRLLTSTSTDVS HQQFMTSGFEDKQSTCE
USP51 (ubiquitin specific peptidase 51) is a protein-coding gene. Diseases associated with USP51 include prostatitis. GO annotations related to this gene include cysteine-type peptidase activity and ubiquitin thiolesterase activity. An important paralog of this gene is USP3.
Citations
Publication ()
Have you cited DPAB-DC692 in a publication? Let us know and earn a reward for your research.
My Review for Anti-USP51 (aa 261-337) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
