Synthetic peptide within Human UBE2E2 aa 1-25 (N terminal). The exact sequence is proprietary.Sequence: MSTEAQRVDDSPSTSGGSSDGDQRESVQQEPEREQVQPKKKEGKISSKTA Database link: Q96LR5
Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes Lys-11- and Lys-48-, as well as Lys-63-linked polyubiquitination.
Pathway
Adaptive Immune System; Antigen processing: Ubiquitination & Proteasome degradation; Class I MHC mediated antigen processing & presentation; Immune System; Protein processing in endoplasmic reticulum
Citations
Publication ()
Have you cited DPABH-12062 in a publication? Let us know and earn a reward for your research.
My Review for Anti-UBE2E2 (aa 1-25) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
