Synthetic peptide within Human UBE2D4 aa 96-145 (C terminal). The exact sequence is proprietary.Sequence: ALTVSKVLLSICSLLCDPNPDDPLVPEIAHTYKADREKYNRLAREWTQKY Database link: Q9Y2X8
Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro able to promote polyubiquitination using all 7 ubiquitin Lys residues, but may prefer Lys-11 and Lys-48-linked polyubiquitination.
Pathway
Adaptive Immune System; Antigen processing: Ubiquitination & Proteasome degradation; Class I MHC mediated antigen processing & presentation; Immune System; Protein processing in endoplasmic reticulum
Citations
Publication ()
Have you cited DPABH-13013 in a publication? Let us know and earn a reward for your research.
My Review for Anti-UBE2D4 (aa 96-145) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
