Synthetic peptide within Human TTC24 aa 449-498 (C terminal). The exact sequence is proprietary. (NP_001099139).Sequence: HRSSSGWEDEEFEEGHQKKKEERSANVPVRAGPGRPELCFLPGTVNHSHH Database link: A2A3L6
Conjugate
Unconjugated
Applications
Application Notes
WB: 1 μg/ml;
Target
Alternative Names
TTC24; tetratricopeptide repeat domain 24; tetratricopeptide repeat protein 24; TPR repeat protein 24;
My Review for Anti-TTC24 (aa 449-498) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
