Synthetic peptide within Human TTC23 aa 383-432 (C terminal). The exact sequence is proprietary.Sequence: LQIQTLLYGPQDKRTLATQQAMGMLSTAPKVASKPRQASKAKVAFCTSIP Database link: Q5W5X9
Conjugate
Unconjugated
Applications
Application Notes
WB: 1 μg/ml;
Target
Alternative Names
TTC23; tetratricopeptide repeat domain 23; HCC-8; tetratricopeptide repeat protein 23; TPR repeat protein 23; cervical cancer proto-oncogene 8 protein;
TTC23 (tetratricopeptide repeat domain 23) is a protein-coding gene. Diseases associated with TTC23 include cervical cancer , and cervicitis. An important paralog of this gene is TTC23L.
Citations
Publication ()
Have you cited DPABH-13238 in a publication? Let us know and earn a reward for your research.
My Review for Anti-TTC23 (aa 383-432) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
