Rabbit Anti-TSPYL2 Polyclonal antibody (DPABH-13357)

Rabbit Anti-Human TSPYL2 Polyclonal antibody for WB, IP, IHC, IF, ELISA Datasheet

Online Inquiry Add to basket

Specifications


Host Species
Rabbit
Antibody Isotype
IgG
Species Reactivity
Human
Immunogen
CDA1 fusion protein, sequence: WHRGQEPQARRHGNQDASHSFFSWFSNHSLPEADRIAEIIKNDLWVNPLRYYLRERGSRIKRKKQEMKKRKTRGRCEVVIMEDAPDYYAVEDIFSEISDIDETIHDIKISDFMETTDYFETTDNEITDINENICDSENPDHNEVPNNETTDNNESADDHETTDNNESADDNNENPEDNNKNTDDNEENPNNNENTYGNNFFKGGFWGSHGNNQDSSDSDNEADEASDDEDNDGNEGDNEGSDDDGNEGDNEGSDDDDRDIEYYEKVIEDFDKDQADYEDVIEIISDESVEEEGIEEGIQQDEDIYEEGNYEEEGSEDVWEEGEDSDDSDLEDVLQVPNGWANPGKRGKTG (C-term-350aa encoded by BC024270)
Conjugate
unconjugated

Applications


Application Notes
WB: 1:500-1:2000
IP: 0.5-4.0 ug for IP and 1:500-1:2000 for WB
IHC: 1:20-1:200
IF: 1:20-1:200
*Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own experiment using appropriate negative and positive controls.

Target


Alternative Names
TSPYL2; TSPY-like 2; CDA1; CTCL; NP79; TSPX
Entrez Gene ID
UniProt ID

Citations


Have you cited DPABH-13357 in a publication? Let us know and earn a reward for your research.

References


Epping, MT; Meijer, LAT; et al. TSPYL5 suppresses p53 levels and function by physical interaction with USP7. NATURE CELL BIOLOGY 13:102-U249(2011).
Ozbun, LL; You, L; et al. Identification of differentially expressed nucleolar TGF-beta 1 target (DENTT) in human lung cancer cells that is a new member of the TSPY/SET/NAP-1 superfamily. GENOMICS 73:179-193(2001).

Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !

Online Inquiry

Name
Phone *
E-mail Address *
Service & Products Interested *
Project Description
Verification Code * Please input "diagnostics" as verification code.

Online Inquiry

Order Info: Rabbit Anti-TSPYL2 Polyclonal antibody

Online Inquiry
  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!
  15% off your first purchase

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket