Rabbit Anti-Human TRIM14 Polyclonal Antibody (DPABH-08000)

Specifications


Host Species
Rabbit
Antibody Isotype
IgG
Species Reactivity
Human
Immunogen
Recombinant Protein, antigen sequence: HIDNITQIEDATEKLKANAESSKTWLKGKFTELRLLLDEEEALAKKFIDKNTQLTLQVYREQADSCREQLDIMNDLS
Conjugate
Unconjugated

Applications


Application Notes
IHC: 1:1000 - 1:2500
ICC-IF: 1-4 µg/ml
*Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own experiment using appropriate negative and positive controls.

Data Examples


Immunohistochemical staining of human tonsil shows moderate cytoplasmic positivity.
Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.

Target


Alternative Names
TRIM14; tripartite motif containing 14; tripartite motif-containing protein 14; tripartite motif-containing 14; tripartite motif protein TRIM14
Entrez Gene ID
UniProt ID

Citations


Have you cited DPABH-08000 in a publication? Let us know and earn a reward for your research.

Related Products


Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket

References


Sun, Y; Biscarini, F; et al. Genetic parameters and across-line SNP associations differ for natural antibody isotypes IgM and IgG in laying hens. ANIMAL GENETICS 44:413-424(2013).

Online Inquiry

Name:
Phone: *
E-mail Address: *
Technology Interest:
Type of Organization:
Service & Products Interested: *
Project Description:
Verification code
Click image to refresh the verification code.

Related Products

Related Resources

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

Inquiry Basket