Synthetic peptide within Mouse TRAM2 aa 321-370 (C terminal). The exact sequence is proprietary.Sequence: YWKEQSAKRRVSAVPRPPAKLLKREPGYHENGVVKAENGTSSRTKKLKSP Database link: Q924Z5
Conjugate
Unconjugated
Applications
Application Notes
WB: 1 μg/ml.
Target
Alternative Names
TRAM2; translocating chain-associating membrane protein 2; translocating chain-associated membrane protein 2; C330003D03Rik; MGC25725;
Necessary for collagen type I synthesis. May couple the activity of the ER Ca(2+) pump SERCA2B with the activity of the translocon. This coupling may increase the local Ca(2+) concentration at the site of collagen synthesis, and a high Ca(2+) concentration may be necessary for the function of molecular chaperones involved in collagen folding.
Citations
Publication ()
Have you cited DPABH-27800 in a publication? Let us know and earn a reward for your research.
My Review for Anti-TRAM2 (aa 321-370) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
