Synthetic peptide within Human GPCR LOC51210 aa 269-318 (C terminal). The exact sequence is proprietary.Sequence: SFFAPLIYVAFLRGFFGSEPKILFSYKCQVDETEEPDVHLPQPYAVARRE Database link: NP_001129525
Conjugate
Unconjugated
Applications
Application Notes
WB: 1 μg/ml;
Target
Alternative Names
TPRA1; transmembrane protein, adipocyte asscociated 1; GPR175; TPRA40; TMEM227; transmembrane protein adipocyte-associated 1; transmembrane protein 227; G protein-coupled receptor 175; integral membrane protein GPR175; seven transmembrane domain orphan re
TPRA1 (transmembrane protein, adipocyte asscociated 1) is a protein-coding gene. Diseases associated with TPRA1 include epididymitis , and hypoxia. GO annotations related to this gene include G-protein coupled receptor activity.
Citations
Publication ()
Have you cited DPABH-12380 in a publication? Let us know and earn a reward for your research.
My Review for Anti-TPRA1 (aa 269-318) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
