Synthetic peptide within Mouse TOM1L1 aa 42-91 (N terminal). The exact sequence is proprietary. Isoform 3Sequence: INTTQDGPKDAVKALKKRISKNYNHKEIQLSLSLIDMCVQNCGPSFQSLI Database link: Q923U0-3
Conjugate
Unconjugated
Applications
Application Notes
WB: 1 μg/ml.
Target
Alternative Names
TOM1L1; target of myb1-like 1 (chicken); TOM1-like protein 1; Jerry protein; target of Myb-like protein 1; Src activating and signaling molecule; src-activating and signaling molecule protein; C80573; Srcasm; 2310045L10Rik;
Probable adapter protein involved in signaling pathways. Interacts with the SH2 and SH3 domains of various signaling proteins when it is phosphorylated. May promotes FYN activation, possibly by disrupting intramolecular SH3-dependent interactions.
Citations
Publication ()
Have you cited DPABH-27762 in a publication? Let us know and earn a reward for your research.
My Review for Anti-TOM1L1 (aa 42-91) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
