Anti-TMEM86B polyclonal antibody (DPABH-10491)

Rabbit anti-Human TMEM86B (full length) polyclonal antibody for WB

Specifications


Host Species
Rabbit
Antibody Isotype
IgG
Species Reactivity
Human
Immunogen
Full length protein corresponding to Human TMEM86B aa 1-226.Sequence: MDAGKAGQTLKTHCSAQRPDVCRWLSPFILSCCVYFCLWIPEDQLSWFAA LVKCLPVLCLAGFLWVMSPSGGYTQLLQGALVCSAVGDACLIWPAAFVPG MAAFATAHLLYVWAFGFSPLQPGLLLLIILAPGPYLSLVLQHLEPDMVLP VAAYGLILMAMLWRGLAQGGSAGWGALLFTLS
Conjugate
Unconjugated

Applications


Application Notes
WB: 1 μg/ml;
*Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own experiment using appropriate negative and positive controls.

Target


Alternative Names
TMEM86B; transmembrane protein 86B; lysoplasmalogenase
Entrez Gene ID
UniProt ID

Citations


Have you cited DPABH-10491 in a publication? Let us know and earn a reward for your research.

Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket

References


Wu, LC; Pfeiffer, DR; et al. Purification, Identification, and Cloning of Lysoplasmalogenase, the Enzyme That Catalyzes Hydrolysis of the Vinyl Ether Bond of Lysoplasmalogen. JOURNAL OF BIOLOGICAL CHEMISTRY 286:24916-24930(2011).
Jurkowitz, MS; Patel, A; et al. The YhhN protein of Legionella pneumophila is a Lysoplasmalogenase. BIOCHIMICA ET BIOPHYSICA ACTA-BIOMEMBRANES 1848:742-751(2015).

Online Inquiry

Name:
Phone: *
E-mail Address: *
Service & Products Interested: *
Project Description:
Verification Code: * Please input "diagnostics" as verification code.

Online Inquiry

  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket