Anti-TMEM54 polyclonal antibody (DPABH-10428)

Rabbit anti-Human TMEM54 (full length) polyclonal antibody for WB

Specifications


Host Species
Rabbit
Antibody Isotype
IgG
Species Reactivity
Human
Immunogen
Recombinant full length protein corresponding to Human TMEM54 aa 1-169. Isoform 3. (AAH23260.1).Sequence: MCLRLGGLSVGDFRKVLMKTGLVLVVLGHVSFITAALFHGTVLRYVGTPQ DAVALQYCVVNILSVTSAIVGKALLAACTFGSSELLALAPDCPFDPTRIY SSSLCLWGIALVLCVAENVFAVRCAQLTHQLLELRPWWGKSSHHMMR
Conjugate
Unconjugated

Applications


Application Notes
WB: 1 μg/ml;
*Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own experiment using appropriate negative and positive controls.

Target


Alternative Names
TMEM54; transmembrane protein 54; BCLP; CAC1; CAC-1; protein CAC-1
Entrez Gene ID
UniProt ID

Citations


Have you cited DPABH-10428 in a publication? Let us know and earn a reward for your research.

Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket

References


Luo, ZH; Zhang, LY; et al. An in silico analysis of dynamic changes in microRNA expression profiles in stepwise development of nasopharyngeal carcinoma. BMC MEDICAL GENOMICS 5:-(2012).

Online Inquiry

Name:
Phone: *
E-mail Address: *
Service & Products Interested: *
Project Description:
Verification Code: * Please input "diagnostics" as verification code.

Online Inquiry

  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket