Synthetic peptide corresponding to a region within C-terminal amino acids 171-220 (TALALSITLGGFGADRFYLGQWREGLGKLFSFGGLGIWTLIDVLLIGVG Y) of Mouse TM2D3 (NP_081071; Q8BJ83 isoform 2).
Conjugate
Unconjugated
Applications
Application Notes
WB: 1 μg/ml.
Target
Alternative Names
TM2D3; TM2 domain containing 3; Blp2; 1110025I09Rik; 5930422O05Rik; TM2 domain-containing protein 3; BBP-like protein 2;
TM2D3 (TM2 domain containing 3) is a protein-coding gene. Diseases associated with TM2D3 include osteoarthritis. An important paralog of this gene is TM2D1.
Citations
Publication ()
Have you cited DPABH-28231 in a publication? Let us know and earn a reward for your research.
My Review for Anti-TM2D3 (aa 171-220) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
