Anti-TBC1D2B polyclonal antibody (DPABH-14734)

Rabbit anti-Human TBC1D2B (aa 258-357) polyclonal antibody for WB, IHC-P

Specifications


Host Species
Rabbit
Antibody Isotype
IgG
Species Reactivity
Human
Immunogen
Recombinant fragment corresponding to Human TBC1D2B aa 258-357 (internal sequence).Sequence: DPTPKDLEESIVQEEKKKLTPEGNKGVTGSGFPFDFGRNPYKGKRPLKDI IGSYKNRHSSGDPSSEGTSGSGSVSIRKPASEMQLQVQSQQEELEQLKKD Database link: Q9UPU7
Conjugate
Unconjugated

Applications


Application Notes
WB: 1/100 - 1/250; IHC-P: 1/50 - 1/200.
*Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own experiment using appropriate negative and positive controls.

Target


Alternative Names
TBC1D2B; TBC1 domain family, member 2B; TBC1 domain family member 2B
Entrez Gene ID
UniProt ID

Citations


Have you cited DPABH-14734 in a publication? Let us know and earn a reward for your research.

Related Products


Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket

References


Kanno, E; Ishibashi, K; et al. Comprehensive Screening for Novel Rab-Binding Proteins by GST Pull-Down Assay Using 60 Different Mammalian Rabs double dagger. TRAFFIC 11:491-507(2010).

Online Inquiry

Name:
Phone: *
E-mail Address: *
Technology Interest:
Type of Organization:
Service & Products Interested: *
Project Description:

Related Products

Related Resources

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

Inquiry Basket