Anti-TAP2 (aa 430-680) polyclonal antibody

Antibody Isotype

IgG

Species Reactivity

Human

Immunogen

Recombinant fragment corresponding to Human TAP2 aa 430-680.Sequence: YGDMLSNVGAAEKVFSYMDRQPNLPSPGTLAPTTLQGVVKFQDVSFAYPN RPDRPVLKGLTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTGGQVLL DEKPISQYEHCYLHSQVVSVGQEPVLFSGSVRNNIAYGLQSCEDDKVMAA AQAAHADDFIQEMEHGIYTDVGEKGSQLAAGQ

Conjugate

Application Notes

IHC-P: 1/50 - 1/200; WB: 1/500 - 1/2000.

Alternative Names

TAP2; transporter 2, ATP-binding cassette, sub-family B (MDR/TAP); ABCB3; antigen peptide transporter 2; D6S217E; PSF2; RING11; ABC transporter, MHC 2; peptide supply factor 2; peptide transporter PSF2; peptide transporter TAP2; really interesting new gen

Entrez Gene ID

UniProt ID

Antigen Description

TAP is an integral transmembrane protein involved in the transport of antigens from the cytoplasm to the endoplasmic reticulum for association with MHC class I molecules. It is a heterodimer of TAP1 and TAP2, and the peptide-binding site is shared between the cytoplasmic loops of TAP1 and TAP2. TAP is inducible by interferon gamma and belongs to the ABC transporter family, MDR subfamily. TAP also acts as a molecular scaffold for the final stage of MHC class I folding, namely the binding of peptide. Nascent MHC class I molecules associate with TAP via tapasin. TAP is inhibited by the covalent attachment of herpes simplex virus ICP47 protein, which blocks the peptide-binding site of TAP. It is inhibited by human cytomegalovirus US6 glycoprotein, which binds to the lumenal side of the TAP complex and inhibits peptide translocation by specifically blocking ATP-binding to TAP and prevents the conformational rearrangement of TAP induced by peptide binding. TAP is also inhibited by human adenovirus E3-19K glycoprotein, which binds the TAP complex and acts as a tapasin inhibitor, preventing MHC class I/TAP association. Expression of TAP is down-regulated by human Epstein-barr virus vIL-10 protein, thereby affecting the transport of peptides into the endoplasmic reticulum and subsequent peptide loading by MHC class I molecules. The allele TAP2*Bky2 is commonly found only in the Japanese population. It may be associated with susceptibility to Sjoegrens syndrome, an autoimmune disorder characterized by abnormal dryness of the conjunctiva, cornea and mouth due to exocrine glands dysfunction.

Pathway

ABC transporters; Adaptive Immune System; Antigen Presentation: Folding, assembly and peptide loading of class I MHC; Antigen processing and presentation; Antigen processing-Cross presentation;